PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00064_0290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family MYB
Protein Properties Length: 867aa    MW: 92469.8 Da    PI: 5.2591
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00064_0290genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding409e-13111155147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT+++d  lv  v+++G  +W++  rt+g  Rt+kqc++rw + 
    kfl00064_0290 111 RSNWTKDDDAALVAFVEKHGLAQWAKAGRTLG--RTGKQCRNRWSNT 155
                      789***********************999997..**********987 PP

2Myb_DNA-binding55.21.7e-17164206347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       WT eE+ +lv+ ++q+G++ W+t +r+m+ gR+++ +k++w++ 
    kfl00064_0290 164 EWTNEEERRLVQFHRQFGSK-WATLSRHMP-GRSPNAIKNHWNNT 206
                      7*******************.*********.************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.14106156IPR017930Myb domain
SuperFamilySSF466892.92E-24110203IPR009057Homeodomain-like
SMARTSM007179.4E-10110158IPR001005SANT/Myb domain
PfamPF002498.3E-10111155IPR001005SANT/Myb domain
CDDcd001679.22E-10113156No hitNo description
Gene3DG3DSA:1.10.10.604.0E-17113163IPR009057Homeodomain-like
PROSITE profilePS5129420.973157211IPR017930Myb domain
SMARTSM007171.8E-14161209IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-18164209IPR009057Homeodomain-like
CDDcd001672.98E-12164207No hitNo description
PfamPF002492.0E-14164205IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 867 aa     Download sequence    Send to blast
MQPTPEAPVP IHFHAPLQKA HSIVAIVGVE EKDEPGPHGE RIKGPPHGGG EAAGPRESSG  60
STGLSTQELR ALARCARGGR ERDLHAETHD SSSTGSSGSD LDLPKRGRTS RSNWTKDDDA  120
ALVAFVEKHG LAQWAKAGRT LGRTGKQCRN RWSNTLEPGL KDVEWTNEEE RRLVQFHRQF  180
GSKWATLSRH MPGRSPNAIK NHWNNTIKCK EQRTSKRERC LVLRDYITSL GGTVESCHMS  240
NPASFDWTDE PLSMDSSKLD PVRPPGEALK TRLSGWASSP LQNPPMRTES DTPSPGFRQM  300
PLFPGECESA PETKKLKTDH VGLEEATGGQ GTTAGGEPRL VRQGSRLNWI KRWAALNPAK  360
QASVAGAVPG AVPVSVGTSV PLTDRMTENE WLRALGMVNG KETEHRIGGL AVEADLKPLT  420
SFGGIALPLD VTSPQVFPAA GGPGQAVSLS PRKRSISDRA ALEESLGWGT FPMMASAPPV  480
VTSPYPVLGS ATSGITSALV QSEDPSSLLT EIIGRPFSTP SDGLSGPGGA GGIPLPTASP  540
VMLTAVAKPS PDQELPGGTE GFPGMSNQRN GIEEDNPLAA LARSLSIEPG VLDSVKPGVS  600
DNPQSENPVL VALVTNHLRS LLDEQAEHLK ETEDAATLTP TQVVRLREQH LQIRSALSFL  660
SSLAGIPDPL SLEADRLSGP RELDERETTL GSVTSSVIRR PDLDPGPFEP SLSPLERGPL  720
KMLPLGDNPV NVTDPRLSYQ GPEELLGVLS RGASLDARML AQLSFPPAEN FPVEQLLHGL  780
SQGLDIPAVS EEIPLQYAPV TPATEWEPRF GQCTLDWPAE SARKTDGFPA AGGIPLEALL  840
DVPPADDTCS FLGGAEYGFP GLGNDHI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-271142107104C-Myb DNA-Binding Domain
1mse_C1e-271142107104C-Myb DNA-Binding Domain
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.14e-31myb domain protein 98